PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA40G00644
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 269aa    MW: 31270.1 Da    PI: 4.7747
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA40G00644genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.6e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l + +   G ++W+ +++  g+ R++k+c++rw +yl
       AA40G00644 14 RGPWTLEEDHRLMNFILNNGIHCWRIVPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding58.81.2e-1867110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +T eE++++ +++ qlG++ W++Ia++++ gRt++++k++w++
       AA40G00644  67 RGGFTDEEEDRIMELHSQLGNR-WSKIASHFP-GRTDNEIKNHWNT 110
                      788*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-20564IPR009057Homeodomain-like
PROSITE profilePS5129413.44961IPR017930Myb domain
SuperFamilySSF466891.14E-2811108IPR009057Homeodomain-like
SMARTSM007174.7E-71363IPR001005SANT/Myb domain
PfamPF002491.1E-111461IPR001005SANT/Myb domain
CDDcd001677.58E-51661No hitNo description
PROSITE profilePS5129427.09862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.9E-2765117IPR009057Homeodomain-like
SMARTSM007173.8E-1666114IPR001005SANT/Myb domain
PfamPF002492.4E-1667110IPR001005SANT/Myb domain
CDDcd001672.46E-1170110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MGRKPCCDKV GLKRGPWTLE EDHRLMNFIL NNGIHCWRIV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGGF TDEEEDRIME LHSQLGNRWS KIASHFPGRT DNEIKNHWNT KIKKKMKHLG  120
LDPVTHKPMD ITSTEQTGSN QEIEPNTSSN IQEEKEPREE EIKTQTPKDE ITIETTNTLI  180
TKSDIDEEEE LMTKNYETLC TEISYNSSLN NSVSIDDYSN NIINISRSES SSYFVEDSSI  240
SLEQWDMDLM DPLIPWDLYT NLDDSLFLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196938.11e-126myb domain protein 40
TrEMBLQ9LY951e-126Q9LY95_ARATH; MYB transcription factor
STRINGAT5G14340.11e-125(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.11e-113myb domain protein 40